Description

Sermorelin is a synthetic 29-amino-acid peptide corresponding to the N-terminal portion of growth hormone-releasing hormone and is supplied for controlled laboratory and analytical research.

Its defined peptide backbone and amidated C-terminal structure make it suitable for scientific work involving peptide identification, receptor-associated biochemical systems, molecular interactions, structural characterization, and related non-clinical experimental models.

Confirm the exact chemical form, salt state, purity specification, and lot-specific analytical profile using the applicable Certificate of Analysis.

Research Applications

Sermorelin may be examined in controlled research settings involving:

• Peptide characterization
• Ligand-receptor interaction studies
• Molecular signaling research
• Structure-function analysis
• Analytical comparison
• Stability studies
• Non-clinical biochemical and cellular models

Any observations should remain limited to the applicable experimental model and should not be interpreted as demonstrating therapeutic effectiveness, hormonal benefit, performance enhancement, or suitability for human use.

Structural Information

Sermorelin contains 29 amino-acid residues and is commonly represented as the amidated peptide:

YADAIFTNSYRKVLGQLSARKLLQDIMSR-NH₂

The C-terminal amide is an important part of the defined structure and should be considered in analytical documentation.

Analytical Identification

Analytical characterization may include:

• Amino-acid sequence confirmation
• Molecular mass assessment
• Chromatographic purity analysis
• Structural verification
• Peptide identity testing
• Lot-specific analytical characterization

Salt forms such as acetate may have molecular specifications that differ from the free-peptide reference values.

Specifications & Documentation

Supporting lot documentation should be reviewed for:

• Compound identity
• Peptide sequence
• Molecular formula
• Molecular weight
• Salt or counter-ion form
• Purity specification
• Analytical testing
• Lot or batch identification
• Certificate of Analysis
• Storage requirements

Authenticated lot-specific analytical documentation should take precedence over generic reference data.

Storage & Handling

Store according to the conditions provided on the product label and Certificate of Analysis. Maintain appropriate laboratory controls and protect the material from environmental conditions that could affect peptide integrity.

Follow established laboratory procedures appropriate for research peptides.

Research Use Only

Sermorelin is supplied exclusively for laboratory research, analytical testing, and scientific reference purposes.

Disclaimer

For research use only. Not for human or veterinary use. Not intended for consumption, administration, hormonal use, performance enhancement, diagnosis, treatment, mitigation, cure, or prevention of any disease. No therapeutic, medical, hormonal, or clinical claims are made or implied. All information is supplied solely for scientific identification, documentation, and research reference.